PDB entry 1r47

View 1r47 on RCSB PDB site
Description: Structure of human alpha-galactosidase
Class: hydrolase
Keywords: glycoprotein, carbohydrate-binding protein, glycosidase, lysosomal enzyme, (beta/alpha)8 barrel, HYDROLASE
Deposited on 2003-10-03, released 2004-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.45 Å
R-factor: 0.285
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-galactosidase A
    Species: Homo sapiens [TaxId:9606]
    Gene: GLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r47a1, d1r47a2
  • Chain 'B':
    Compound: Alpha-galactosidase A
    Species: Homo sapiens [TaxId:9606]
    Gene: GLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r47b1, d1r47b2
  • Heterogens: GAL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r47A (A:)
    ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
    ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
    ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
    qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
    nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdplgkqgyql
    rqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacfitqllpvk
    rklgfyewtsrlrshinptgtvllqlentmqmslkdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r47A (A:)
    ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
    ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
    ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
    qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
    nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdplgkqgyql
    rqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacfitqllpvk
    rklgfyewtsrlrshinptgtvllqlentm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r47B (B:)
    ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
    ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
    ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
    qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
    nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdplgkqgyql
    rqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacfitqllpvk
    rklgfyewtsrlrshinptgtvllqlentmqmslkdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r47B (B:)
    ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
    ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
    ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
    qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
    nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdplgkqgyql
    rqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacfitqllpvk
    rklgfyewtsrlrshinptgtvllqlentmq