SCOPe 2.08: Domain d1qwdb1: 1qwd B:23-175

Lineage for d1qwdb1 (1qwd B:23-175)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Outer membrane lipoprotein Blc [101861] (1 species)
   bacterial lipocalin

7. Species Escherichia coli [TaxId:562] [101862] (1 PDB entry)

8. Domain d1qwdb1: 1qwd B:23-175 [96472]
   Other proteins in same PDB: d1qwda2, d1qwdb2

Details for d1qwdb1

PDB Entry: 1qwd, 1.75 Å

PDB Description: crystal structure of a bacterial lipocalin, the blc gene product from e. coli

PDB Compounds: (B:) Outer membrane lipoprotein blc

SCOPe Domain Sequences for d1qwdb1:

Sequence; same for both SEQRES and ATOM records:

>d1qwdb1 b.60.1.1 (B:23-175) Outer membrane lipoprotein Blc {Escherichia coli [TaxId: 562]}
tpprgvtvvnnfdakrylgtwyeiarfdhrferglekvtatyslrddgglnvinkgynpd
rgmwqqsegkayftgaptraalkvsffgpfyggynvialdreyrhalvcgpdrdylwils
rtptisdevkqemlavatregfdvskfiwvqqp

Timeline for d1qwdb1:

• d1qwdb1 first appeared in SCOP 1.67, called d1qwdb_
  
• d1qwdb1 appears in SCOPe 2.07