SCOPe 2.08: Domain d1qwda1: 1qwd A:23-176

Lineage for d1qwda1 (1qwd A:23-176)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Outer membrane lipoprotein Blc [101861] (1 species)
   bacterial lipocalin

7. Species Escherichia coli [TaxId:562] [101862] (1 PDB entry)

8. Domain d1qwda1: 1qwd A:23-176 [96471]
   Other proteins in same PDB: d1qwda2, d1qwdb2

Details for d1qwda1

PDB Entry: 1qwd, 1.75 Å

PDB Description: crystal structure of a bacterial lipocalin, the blc gene product from e. coli

PDB Compounds: (A:) Outer membrane lipoprotein blc

SCOPe Domain Sequences for d1qwda1:

Sequence; same for both SEQRES and ATOM records:

>d1qwda1 b.60.1.1 (A:23-176) Outer membrane lipoprotein Blc {Escherichia coli [TaxId: 562]}
tpprgvtvvnnfdakrylgtwyeiarfdhrferglekvtatyslrddgglnvinkgynpd
rgmwqqsegkayftgaptraalkvsffgpfyggynvialdreyrhalvcgpdrdylwils
rtptisdevkqemlavatregfdvskfiwvqqpg

Timeline for d1qwda1:

• d1qwda1 first appeared in SCOP 1.67, called d1qwda_
  
• d1qwda1 appears in SCOPe 2.07