Lineage for d1qwda1 (1qwd A:23-176)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804704Protein Outer membrane lipoprotein Blc [101861] (1 species)
    bacterial lipocalin
  7. 2804705Species Escherichia coli [TaxId:562] [101862] (1 PDB entry)
  8. 2804706Domain d1qwda1: 1qwd A:23-176 [96471]
    Other proteins in same PDB: d1qwda2, d1qwdb2

Details for d1qwda1

PDB Entry: 1qwd (more details), 1.75 Å

PDB Description: crystal structure of a bacterial lipocalin, the blc gene product from e. coli
PDB Compounds: (A:) Outer membrane lipoprotein blc

SCOPe Domain Sequences for d1qwda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qwda1 b.60.1.1 (A:23-176) Outer membrane lipoprotein Blc {Escherichia coli [TaxId: 562]}
tpprgvtvvnnfdakrylgtwyeiarfdhrferglekvtatyslrddgglnvinkgynpd
rgmwqqsegkayftgaptraalkvsffgpfyggynvialdreyrhalvcgpdrdylwils
rtptisdevkqemlavatregfdvskfiwvqqpg

SCOPe Domain Coordinates for d1qwda1:

Click to download the PDB-style file with coordinates for d1qwda1.
(The format of our PDB-style files is described here.)

Timeline for d1qwda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qwda2