Lineage for d1qvgn_ (1qvg N:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852065Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 2852066Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 2852067Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 2852159Protein Ribosomal protein L18e [52084] (1 species)
  7. 2852160Species Haloarcula marismortui [TaxId:2238] [52085] (40 PDB entries)
    Uniprot P12733
  8. 2852195Domain d1qvgn_: 1qvg N: [96406]
    Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1qvgn_

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (N:) 50S ribosomal protein L18e

SCOPe Domain Sequences for d1qvgn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvgn_ c.12.1.1 (N:) Ribosomal protein L18e {Haloarcula marismortui [TaxId: 2238]}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

SCOPe Domain Coordinates for d1qvgn_:

Click to download the PDB-style file with coordinates for d1qvgn_.
(The format of our PDB-style files is described here.)

Timeline for d1qvgn_: