SCOPe 2.08: Domain d1qvgm_: 1qvg M:

Lineage for d1qvgm_ (1qvg M:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.4: Translational machinery components [53137] (3 families)

5. Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)

6. Protein Ribosomal protein L18 (L18p) [53139] (5 species)

7. Species Haloarcula marismortui [TaxId:2238] [53140] (40 PDB entries)
   Uniprot P14123

8. Domain d1qvgm_: 1qvg M: [96405]
   Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
   protein/RNA complex; complexed with cd, cl, k, mg, na
   has additional insertions and/or extensions that are not grouped together

Details for d1qvgm_

PDB Entry: 1qvg, 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (M:) 50S ribosomal protein L18P

SCOPe Domain Sequences for d1qvgm_:

Sequence; same for both SEQRES and ATOM records:

>d1qvgm_ c.55.4.1 (M:) Ribosomal protein L18 (L18p) {Haloarcula marismortui [TaxId: 2238]}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

Timeline for d1qvgm_:

• d1qvgm_ first appeared in SCOP 1.67
  
• d1qvgm_ appears in SCOPe 2.07