Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
Protein N-terminal domain of ribosomal protein L2 [50299] (5 species) incomplete OB-fold lacking the last strand |
Species Haloarcula marismortui [TaxId:2238] [50301] (40 PDB entries) Uniprot P20276 includes the N-terminal tail |
Domain d1qvga2: 1qvg A:1-90 [96392] Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_ protein/RNA complex; complexed with cd, cl, k, mg, na missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1qvg (more details), 2.9 Å
SCOPe Domain Sequences for d1qvga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qvga2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]} grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef edgdrrlilapegvgvgdelqvgvdaeiap
Timeline for d1qvga2:
View in 3D Domains from other chains: (mouse over for more information) d1qvg1_, d1qvg2_, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_ |