SCOPe 2.08: Domain d1qvgu_: 1qvg U:

Lineage for d1qvgu_ (1qvg U:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family)
   automatically mapped to Pfam PF00831

5. Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)

6. Protein Ribosomal protein L29 (L29p) [46563] (5 species)

7. Species Haloarcula marismortui [TaxId:2238] [46564] (40 PDB entries)
   Uniprot P10971

8. Domain d1qvgu_: 1qvg U: [96413]
   Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
   protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1qvgu_

PDB Entry: 1qvg, 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (U:) 50S ribosomal protein L29P

SCOPe Domain Sequences for d1qvgu_:

Sequence; same for both SEQRES and ATOM records:

>d1qvgu_ a.2.2.1 (U:) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

Timeline for d1qvgu_:

• d1qvgu_ first appeared in SCOP 1.67
  
• d1qvgu_ appears in SCOPe 2.07