SCOP 1.67: Domain d1q81c1: 1q81 C:91-237

Lineage for d1q81c1 (1q81 C:91-237)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.34: SH3-like barrel [50036] (15 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families)
   many known members contain KOW motif

5. Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)

6. Protein C-terminal domain of ribosomal protein L2 [50115] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50117] (18 PDB entries)

8. Domain d1q81c1: 1q81 C:91-237 [96098]
   Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_
   complexed with cd, cl, k, mg, na, ppu

Details for d1q81c1

PDB Entry: 1q81, 2.95 Å

PDB Description: crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.

SCOP Domain Sequences for d1q81c1:

Sequence; same for both SEQRES and ATOM records:

>d1q81c1 b.34.5.3 (C:91-237) C-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvggggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

Timeline for d1q81c1:

• d1q81c1 is new in SCOP 1.67
  
• d1q81c1 appears in SCOP 1.69
  
• d1q81c1 appears in the current release, SCOPe 2.08