Lineage for d1q81g2 (1q81 G:80-172)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418863Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 418864Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 418865Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 418866Protein Ribosomal protein L6 [56055] (2 species)
    duplication: consists of two domains of this fold
  7. 418867Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (18 PDB entries)
  8. 418879Domain d1q81g2: 1q81 G:80-172 [96104]
    Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_
    complexed with cd, cl, k, mg, na, ppu

Details for d1q81g2

PDB Entry: 1q81 (more details), 2.95 Å

PDB Description: crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.

SCOP Domain Sequences for d1q81g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q81g2 d.141.1.1 (G:80-172) Ribosomal protein L6 {Archaeon Haloarcula marismortui}
weygmevfyshfpmqvnvegdevvienflgekaprrttihgdtdveidgeeltvsgpdie
avgqtaadieqltrindkdvrvfqdgvyitrkp

SCOP Domain Coordinates for d1q81g2:

Click to download the PDB-style file with coordinates for d1q81g2.
(The format of our PDB-style files is described here.)

Timeline for d1q81g2: