SCOP 1.67: Domain d1q81w_: 1q81 W:

Lineage for d1q81w_ (1q81 W:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.2: Long alpha-hairpin [46556] (12 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family)

5. Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)

6. Protein Ribosomal protein L29 (L29p) [46563] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (18 PDB entries)

8. Domain d1q81w_: 1q81 W: [96120]
   Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81x_, d1q81y_, d1q81z_
   complexed with cd, cl, k, mg, na, ppu

Details for d1q81w_

PDB Entry: 1q81, 2.95 Å

PDB Description: crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.

SCOP Domain Sequences for d1q81w_:

Sequence; same for both SEQRES and ATOM records:

>d1q81w_ a.2.2.1 (W:) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

Timeline for d1q81w_:

• d1q81w_ is new in SCOP 1.67
  
• d1q81w_ appears in SCOP 1.69
  
• d1q81w_ appears in the current release, SCOPe 2.08