SCOP 1.67: Domain d1q81v_: 1q81 V:

Lineage for d1q81v_ (1q81 V:)

1. Root: SCOP 1.67

2. Class g: Small proteins [56992] (72 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (11 families)

5. Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)

6. Protein Ribosomal protein L24e [57750] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [57751] (18 PDB entries)

8. Domain d1q81v_: 1q81 V: [96119]
   Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81w_, d1q81x_, d1q81y_, d1q81z_
   complexed with cd, cl, k, mg, na, ppu

Details for d1q81v_

PDB Entry: 1q81, 2.95 Å

PDB Description: crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.

SCOP Domain Sequences for d1q81v_:

Sequence; same for both SEQRES and ATOM records:

>d1q81v_ g.39.1.6 (V:) Ribosomal protein L24e {Archaeon Haloarcula marismortui}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

Timeline for d1q81v_:

• d1q81v_ is new in SCOP 1.67
  
• d1q81v_ appears in SCOP 1.69
  
• d1q81v_ appears in the current release, SCOPe 2.08