SCOPe 2.08: Domain d1q7y3_: 1q7y 3:

Lineage for d1q7y3_ (1q7y 3:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family)
   interrupted alpha-helix
   automatically mapped to Pfam PF00832

5. Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)

6. Protein Ribosomal protein L39e [48664] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
   Uniprot P22452

8. Domain d1q7y3_: 1q7y 3: [96062]
   Other proteins in same PDB: d1q7y1_, d1q7y2_, d1q7y4_, d1q7yc1, d1q7yc2, d1q7yd_, d1q7ye_, d1q7yf_, d1q7yg1, d1q7yg2, d1q7yh_, d1q7yi_, d1q7yj_, d1q7yk_, d1q7yl_, d1q7ym_, d1q7yn_, d1q7yo_, d1q7yp_, d1q7yq_, d1q7yr_, d1q7ys_, d1q7yt_, d1q7yu_, d1q7yv_, d1q7yw_, d1q7yx_, d1q7yy_, d1q7yz_
   protein/RNA complex; complexed with cd, cl, k, mg, na, po4, puy

Details for d1q7y3_

PDB Entry: 1q7y, 3.2 Å

PDB Description: crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit

PDB Compounds: (3:) 50S ribosomal protein L39e

SCOPe Domain Sequences for d1q7y3_:

Sequence, based on SEQRES records:

>d1q7y3_ a.137.1.1 (3:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records):

>d1q7y3_ a.137.1.1 (3:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde

Timeline for d1q7y3_:

• d1q7y3_ first appeared in SCOP 1.67
  
• d1q7y3_ appears in SCOPe 2.07