Lineage for d1q7ym_ (1q7y M:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2098879Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 2098880Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 2098881Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 protein domains)
  6. 2098882Protein Ribosomal protein L15 (L15p) [52082] (4 species)
  7. 2098920Species Haloarcula marismortui [TaxId:2238] [52083] (40 PDB entries)
    Uniprot P12737
  8. 2098959Domain d1q7ym_: 1q7y M: [96076]
    Other proteins in same PDB: d1q7y1_, d1q7y2_, d1q7y3_, d1q7y4_, d1q7yc1, d1q7yc2, d1q7yd_, d1q7ye_, d1q7yf_, d1q7yg1, d1q7yg2, d1q7yh_, d1q7yi_, d1q7yj_, d1q7yk_, d1q7yl_, d1q7yn_, d1q7yo_, d1q7yp_, d1q7yq_, d1q7yr_, d1q7ys_, d1q7yt_, d1q7yu_, d1q7yv_, d1q7yw_, d1q7yx_, d1q7yy_, d1q7yz_
    protein/RNA complex; complexed with cd, cl, k, mg, na, po4, puy

Details for d1q7ym_

PDB Entry: 1q7y (more details), 3.2 Å

PDB Description: Crystal Structure of CCdAP-Puromycin bound at the Peptidyl transferase center of the 50S ribosomal subunit
PDB Compounds: (M:) 50S ribosomal protein L15P

SCOPe Domain Sequences for d1q7ym_:

Sequence, based on SEQRES records: (download)

>d1q7ym_ c.12.1.1 (M:) Ribosomal protein L15 (L15p) {Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
iaddfsegarekvegaggsveltdlgeerq

Sequence, based on observed residues (ATOM records): (download)

>d1q7ym_ c.12.1.1 (M:) Ribosomal protein L15 (L15p) {Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
segarekvegaggsveltdlgeerq

SCOPe Domain Coordinates for d1q7ym_:

Click to download the PDB-style file with coordinates for d1q7ym_.
(The format of our PDB-style files is described here.)

Timeline for d1q7ym_: