Lineage for d1q7yc2 (1q7y C:1-90)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2789812Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
    incomplete OB-fold lacking the last strand
  7. 2789850Species Haloarcula marismortui [TaxId:2238] [50301] (40 PDB entries)
    Uniprot P20276
    includes the N-terminal tail
  8. 2789890Domain d1q7yc2: 1q7y C:1-90 [96065]
    Other proteins in same PDB: d1q7y1_, d1q7y2_, d1q7y3_, d1q7y4_, d1q7yc1, d1q7yd_, d1q7ye_, d1q7yf_, d1q7yg1, d1q7yg2, d1q7yh_, d1q7yi_, d1q7yj_, d1q7yk_, d1q7yl_, d1q7ym_, d1q7yn_, d1q7yo_, d1q7yp_, d1q7yq_, d1q7yr_, d1q7ys_, d1q7yt_, d1q7yu_, d1q7yv_, d1q7yw_, d1q7yx_, d1q7yy_, d1q7yz_
    protein/RNA complex; complexed with cd, cl, k, mg, na, po4, puy
    missing some secondary structures that made up less than one-third of the common domain

Details for d1q7yc2

PDB Entry: 1q7y (more details), 3.2 Å

PDB Description: crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
PDB Compounds: (C:) 50S ribosomal protein L2P

SCOPe Domain Sequences for d1q7yc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q7yc2 b.40.4.5 (C:1-90) N-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvdaeiap

SCOPe Domain Coordinates for d1q7yc2:

Click to download the PDB-style file with coordinates for d1q7yc2.
(The format of our PDB-style files is described here.)

Timeline for d1q7yc2:

2789890
d1q7yc2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1q7yc1