Lineage for d1q6va_ (1q6v A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733242Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (39 PDB entries)
    Uniprot P59071
  8. 2733266Domain d1q6va_: 1q6v A: [95999]
    complexed with so4

Details for d1q6va_

PDB Entry: 1q6v (more details), 1.86 Å

PDB Description: First crystal structure of a C49 monomer PLA2 from the venom of Daboia russelli pulchella at 1.8 A resolution
PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d1q6va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q6va_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycggcgsgtpkdatdrccfvhcccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntysgkymlypdflckgelk
c

SCOPe Domain Coordinates for d1q6va_:

Click to download the PDB-style file with coordinates for d1q6va_.
(The format of our PDB-style files is described here.)

Timeline for d1q6va_: