PDB entry 1q6v

View 1q6v on RCSB PDB site
Description: First crystal structure of a C49 monomer PLA2 from the venom of Daboia russelli pulchella at 1.8 A resolution
Class: hydrolase
Keywords: Phospholipase A2, catalysis, isoform, HYDROLASE
Deposited on 2003-08-14, released 2004-05-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.204
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 VRV-PL-VIIIa
    Species: Daboia russellii pulchella [TaxId:97228]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59071 (0-110)
      • see remark 999 (28)
      • see remark 999 (30)
      • see remark 999 (32)
      • see remark 999 (47)
      • see remark 999 (104)
    Domains in SCOPe 2.08: d1q6va_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1q6vA (A:)
sllefgkmileetgklaipsyssygcycggcgsgtpkdatdrccfvhcccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntysgkymlypdflckgelk
c