Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (14 families) regulatory domain linked to a wide range of metabolic enzymes |
Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (1 protein) |
Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species) |
Species Escherichia coli [TaxId:562] [103001] (7 PDB entries) |
Domain d1q5yb_: 1q5y B: [95951] nickel-bound; C-terminal domain only complexed with edo, ni |
PDB Entry: 1q5y (more details), 1.4 Å
SCOPe Domain Sequences for d1q5yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q5yb_ d.58.18.4 (B:) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]} tqgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdvq hfaddviaqrgvrhghlqclpke
Timeline for d1q5yb_: