![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.18: ACT-like [55021] (4 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
![]() | Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (1 protein) |
![]() | Protein Nickel responsive regulator NikR, C-terminal domain [103000] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [103001] (2 PDB entries) |
![]() | Domain d1q5yb_: 1q5y B: [95951] |
PDB Entry: 1q5y (more details), 1.4 Å
SCOP Domain Sequences for d1q5yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q5yb_ d.58.18.4 (B:) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli} tqgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdvq hfaddviaqrgvrhghlqclpke
Timeline for d1q5yb_: