Lineage for d1q5yb_ (1q5y B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 863190Superfamily d.58.18: ACT-like [55021] (14 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 863230Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (1 protein)
  6. 863231Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species)
  7. 863245Species Escherichia coli [TaxId:562] [103001] (7 PDB entries)
  8. 863247Domain d1q5yb_: 1q5y B: [95951]
    nickel-bound; C-terminal domain only

Details for d1q5yb_

PDB Entry: 1q5y (more details), 1.4 Å

PDB Description: Nickel-Bound C-terminal Regulatory Domain of NikR
PDB Compounds: (B:) nickel responsive regulator

SCOP Domain Sequences for d1q5yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q5yb_ d.58.18.4 (B:) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]}
tqgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdvq
hfaddviaqrgvrhghlqclpke

SCOP Domain Coordinates for d1q5yb_:

Click to download the PDB-style file with coordinates for d1q5yb_.
(The format of our PDB-style files is described here.)

Timeline for d1q5yb_: