Lineage for d1q4v.1 (1q4v B:,A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029609Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 3029610Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 3029611Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 3029616Protein Insulin [56996] (3 species)
  7. 3029626Species Human (Homo sapiens) [TaxId:9606] [56998] (63 PDB entries)
    Uniprot P01308
  8. 3029673Domain d1q4v.1: 1q4v B:,A: [95830]
    complexed with iph, zn

Details for d1q4v.1

PDB Entry: 1q4v (more details), 2 Å

PDB Description: crystal structure of allo-ilea2-insulin, an inactive chiral analogue: implications for the mechanism of receptor
PDB Compounds: (A:) insulin, (B:) insulin

SCOPe Domain Sequences for d1q4v.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1q4v.1 g.1.1.1 (B:,A:) Insulin {Human (Homo sapiens) [TaxId: 9606]}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d1q4v.1:

Click to download the PDB-style file with coordinates for d1q4v.1.
(The format of our PDB-style files is described here.)

Timeline for d1q4v.1: