Lineage for d1q1ra2 (1q1r A:115-247)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. Protein Putidaredoxin reductase, middle domain [418953] (1 species)
  7. Species Pseudomonas putida [TaxId:303] [419409] (2 PDB entries)
  8. 2850163Domain d1q1ra2: 1q1r A:115-247 [95601]
    Other proteins in same PDB: d1q1ra1, d1q1ra3, d1q1rb1, d1q1rb3
    complexed with fad

Details for d1q1ra2

PDB Entry: 1q1r (more details), 1.91 Å

PDB Description: Crystal Structure of Putidaredoxin Reductase from Pseudomonas putida
PDB Compounds: (A:) Putidaredoxin reductase

SCOPe Domain Sequences for d1q1ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase, middle domain {Pseudomonas putida [TaxId: 303]}
rplpvasgavgkannfrylrtledaecirrqliadnrlvvigggyiglevaataikanmh
vtlldtaarvlervtappvsafyehlhreagvdirtgtqvcgfemstdqqkvtavlcedg
trlpadlviagig

SCOPe Domain Coordinates for d1q1ra2:

Click to download the PDB-style file with coordinates for d1q1ra2.
(The format of our PDB-style files is described here.)

Timeline for d1q1ra2: