PDB entry 1q1r

View 1q1r on RCSB PDB site
Description: Crystal Structure of Putidaredoxin Reductase from Pseudomonas putida
Class: oxidoreductase
Keywords: glutathione reductase fold, OXIDOREDUCTASE
Deposited on 2003-07-22, released 2004-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.213
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putidaredoxin reductase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q1ra1, d1q1ra2, d1q1ra3
  • Chain 'B':
    Compound: Putidaredoxin reductase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q1rb1, d1q1rb2, d1q1rb3
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q1rA (A:)
    mnandnvvivgtglagvevafglrasgwegnirlvgdatviphhlpplskaylagkatae
    slylrtpdayaaqniqllggtqvtainrdrqqvilsdgraldydrlvlatggrprplpva
    sgavgkannfrylrtledaecirrqliadnrlvvigggyiglevaataikanmhvtlldt
    aarvlervtappvsafyehlhreagvdirtgtqvcgfemstdqqkvtavlcedgtrlpad
    lviagiglipncelasaaglqvdngivinehmqtsdplimavgdcarfhsqlydrwvrie
    svpnaleqarkiaailcgkvprdeaapwfwsdqyeiglkmvglsegydriivrgslaqpd
    fsvfylqgdrvlavdtvnrpvefnqskqiitdrlpvepnllgdesvplkeiiaaakaels
    saparhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q1rA (A:)
    nandnvvivgtglagvevafglrasgwegnirlvgdatviphhlpplskaylagkataes
    lylrtpdayaaqniqllggtqvtainrdrqqvilsdgraldydrlvlatggrprplpvas
    gavgkannfrylrtledaecirrqliadnrlvvigggyiglevaataikanmhvtlldta
    arvlervtappvsafyehlhreagvdirtgtqvcgfemstdqqkvtavlcedgtrlpadl
    viagiglipncelasaaglqvdngivinehmqtsdplimavgdcarfhsqlydrwvries
    vpnaleqarkiaailcgkvprdeaapwfwsdqyeiglkmvglsegydriivrgslaqpdf
    svfylqgdrvlavdtvnrpvefnqskqiitdrlpvepnllgdesvplkeiiaaakaelss
    a
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q1rB (B:)
    mnandnvvivgtglagvevafglrasgwegnirlvgdatviphhlpplskaylagkatae
    slylrtpdayaaqniqllggtqvtainrdrqqvilsdgraldydrlvlatggrprplpva
    sgavgkannfrylrtledaecirrqliadnrlvvigggyiglevaataikanmhvtlldt
    aarvlervtappvsafyehlhreagvdirtgtqvcgfemstdqqkvtavlcedgtrlpad
    lviagiglipncelasaaglqvdngivinehmqtsdplimavgdcarfhsqlydrwvrie
    svpnaleqarkiaailcgkvprdeaapwfwsdqyeiglkmvglsegydriivrgslaqpd
    fsvfylqgdrvlavdtvnrpvefnqskqiitdrlpvepnllgdesvplkeiiaaakaels
    saparhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q1rB (B:)
    nandnvvivgtglagvevafglrasgwegnirlvgdatviphhlpplskaylagkataes
    lylrtpdayaaqniqllggtqvtainrdrqqvilsdgraldydrlvlatggrprplpvas
    gavgkannfrylrtledaecirrqliadnrlvvigggyiglevaataikanmhvtlldta
    arvlervtappvsafyehlhreagvdirtgtqvcgfemstdqqkvtavlcedgtrlpadl
    viagiglipncelasaaglqvdngivinehmqtsdplimavgdcarfhsqlydrwvries
    vpnaleqarkiaailcgkvprdeaapwfwsdqyeiglkmvglsegydriivrgslaqpdf
    svfylqgdrvlavdtvnrpvefnqskqiitdrlpvepnllgdesvplkeiiaaakaelss
    a