Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) |
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
Protein Putidaredoxin reductase, N- and C-terminal domain [418952] (1 species) |
Species Pseudomonas putida [TaxId:303] [419408] (2 PDB entries) |
Domain d1q1ra1: 1q1r A:2-114,A:248-319 [95600] Other proteins in same PDB: d1q1ra2, d1q1ra3, d1q1rb2, d1q1rb3 complexed with fad has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1q1r (more details), 1.91 Å
SCOPe Domain Sequences for d1q1ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase, N- and C-terminal domain {Pseudomonas putida [TaxId: 303]} nandnvvivgtglagvevafglrasgwegnirlvgdatviphhlpplskaylagkataes lylrtpdayaaqniqllggtqvtainrdrqqvilsdgraldydrlvlatggrpXlipnce lasaaglqvdngivinehmqtsdplimavgdcarfhsqlydrwvriesvpnaleqarkia ailcgk
Timeline for d1q1ra1: