SCOPe 2.08: Domain d1q19c2: 1q19 C:2-205

Lineage for d1q19c2 (1q19 C:2-205)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
   has slightly different topology than other families do

6. Protein beta-Lactam synthetase [69831] (2 species)
   Asparagine synthetase B homologue

7. Species Pectobacterium carotovorum [TaxId:554] [103312] (2 PDB entries)
   carbapenam synthetase CarA

8. Domain d1q19c2: 1q19 C:2-205 [95558]
   Other proteins in same PDB: d1q19a1, d1q19b1, d1q19c1, d1q19d1
   complexed with apc, mg, ssc

Details for d1q19c2

PDB Entry: 1q19, 2.4 Å

PDB Description: Carbapenam Synthetase

PDB Compounds: (C:) CarA

SCOPe Domain Sequences for d1q19c2:

Sequence; same for both SEQRES and ATOM records:

>d1q19c2 d.153.1.1 (C:2-205) beta-Lactam synthetase {Pectobacterium carotovorum [TaxId: 554]}
snsfcvvykgsdtdinniqrdfdgkgealsngylfieqnghyqkcemergtayligslyn
rtfliglagvwegeaylandaellallftrlganalalaegdfcffidepngeltvites
rgfspvhvvqgkkawmtnslklvtaaegegalwfeeealvcqslmradtytpvknaqrlk
pgavhvlthdsegysfvesrtltt

Timeline for d1q19c2:

• d1q19c2 first appeared in SCOP 1.67
  
• d1q19c2 appears in SCOPe 2.07