![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
![]() | Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins) |
![]() | Protein beta-Lactam synthetase [69456] (2 species) Asparagine synthetase B homologue |
![]() | Species Pectobacterium carotovorum [TaxId:554] [102263] (2 PDB entries) carbapenam synthetase CarA |
![]() | Domain d1q19d1: 1q19 D:206-501 [95559] Other proteins in same PDB: d1q19a2, d1q19b2, d1q19c2, d1q19d2 complexed with apc, mg, ssc has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1q19 (more details), 2.4 Å
SCOPe Domain Sequences for d1q19d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q19d1 c.26.2.1 (D:206-501) beta-Lactam synthetase {Pectobacterium carotovorum [TaxId: 554]} pasnqllalprepllalidrylnapledlaprfdtvgiplsggldsslvtalasrhfkkl ntysigtelsnefefsqqvadalgthhqmkilsetevingiiesiyyneifdglsaeiqs glfnvyrqaqgqvscmltgygsdllfggilkpgaqydnpnqllaeqvyrtrwtgefathg ascygidirhpfwshslislchalhpdykifdnevknilreyadslqllpkdivwrkkig ihegssvnqafanvlgstvdnyqtksrftyrvyqaflrgrlsitdvtpsqlkdlik
Timeline for d1q19d1: