Lineage for d1q19c2 (1q19 C:2-205)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594582Family d.153.1.1: Class II glutamine amidotransferases [56236] (7 proteins)
    has slightly different topology than other families do
  6. 2594607Protein beta-Lactam synthetase [69831] (2 species)
    Asparagine synthetase B homologue
  7. 2594608Species Pectobacterium carotovorum [TaxId:554] [103312] (2 PDB entries)
    carbapenam synthetase CarA
  8. 2594615Domain d1q19c2: 1q19 C:2-205 [95558]
    Other proteins in same PDB: d1q19a1, d1q19b1, d1q19c1, d1q19d1
    complexed with apc, mg, ssc

Details for d1q19c2

PDB Entry: 1q19 (more details), 2.4 Å

PDB Description: Carbapenam Synthetase
PDB Compounds: (C:) CarA

SCOPe Domain Sequences for d1q19c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q19c2 d.153.1.1 (C:2-205) beta-Lactam synthetase {Pectobacterium carotovorum [TaxId: 554]}
snsfcvvykgsdtdinniqrdfdgkgealsngylfieqnghyqkcemergtayligslyn
rtfliglagvwegeaylandaellallftrlganalalaegdfcffidepngeltvites
rgfspvhvvqgkkawmtnslklvtaaegegalwfeeealvcqslmradtytpvknaqrlk
pgavhvlthdsegysfvesrtltt

SCOPe Domain Coordinates for d1q19c2:

Click to download the PDB-style file with coordinates for d1q19c2.
(The format of our PDB-style files is described here.)

Timeline for d1q19c2: