SCOP 1.73: Domain d1pzgc1: 1pzg C:15-163

Lineage for d1pzgc1 (1pzg C:15-163)

Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)
Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
Protein Lactate dehydrogenase [51859] (14 species)
Species Toxoplasma gondii [TaxId:5811] [102166] (4 PDB entries)
Domain d1pzgc1: 1pzg C:15-163 [95429]
Other proteins in same PDB: d1pzga2, d1pzgb2, d1pzgc2, d1pzgd2

Details for d1pzgc1

PDB Entry: 1pzg (more details), 1.6 Å

PDB Description: T.gondii LDH1 complexed with APAD and sulfate at 1.6 Angstroms

PDB Compounds: (C:) lactate dehydrogenase

SCOP Domain Sequences for d1pzgc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzgc1 c.2.1.5 (C:15-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}
alvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdtn
vsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikkyc
pktfiivvtnpldcmvkvmceasgvptnmicgm

SCOP Domain Coordinates for d1pzgc1:

Click to download the PDB-style file with coordinates for d1pzgc1.
(The format of our PDB-style files is described here.)

Timeline for d1pzgc1: