SCOP 1.73: Domain d1pzgc2: 1pzg C:164-332

Lineage for d1pzgc2 (1pzg C:164-332)

Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
unusual fold, defines family
Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families)
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
Protein Lactate dehydrogenase [56339] (15 species)
Species Toxoplasma gondii [TaxId:5811] [103326] (4 PDB entries)
Domain d1pzgc2: 1pzg C:164-332 [95430]
Other proteins in same PDB: d1pzga1, d1pzgb1, d1pzgc1, d1pzgd1

Details for d1pzgc2

PDB Entry: 1pzg (more details), 1.6 Å

PDB Description: T.gondii LDH1 complexed with APAD and sulfate at 1.6 Angstroms

PDB Compounds: (C:) lactate dehydrogenase

SCOP Domain Sequences for d1pzgc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzgc2 d.162.1.1 (C:164-332) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}
acmldsgrfrryvadalsvsprdvqatvigthgdcmvplvryitvngypiqkfikdgvvt
ekqleeiaehtkvsggeivrflgqgsayyapaasavamatsflndekrvipcsvycngey
glkdmfiglpaviggagiervielelneeekkqfqksvddvmalnkavaalq

SCOP Domain Coordinates for d1pzgc2:

Click to download the PDB-style file with coordinates for d1pzgc2.
(The format of our PDB-style files is described here.)

Timeline for d1pzgc2: