SCOP 1.71: Domain d1pyfa_: 1pyf A:

Lineage for d1pyfa_ (1pyf A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (15 proteins)
   Common fold covers whole protein structure

6. Protein Putative oxidoreductase IolS [102054] (1 species)
   vegetative protein 147, VEG147, AKR11A

7. Species Bacillus subtilis [TaxId:1423] [102055] (2 PDB entries)

8. Domain d1pyfa_: 1pyf A: [95334]
   complexed with egl, na

Details for d1pyfa_

PDB Entry: 1pyf, 1.8 Å

PDB Description: Structure of NADPH-dependent family 11 aldo-keto reductase AKR11A(apo)

SCOP Domain Sequences for d1pyfa_:

Sequence; same for both SEQRES and ATOM records:

>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis}
kkaklgksdlqvfpiglgtnavgghnlypnlneetgkelvreairngvtmldtayiygig
rseeligevlrefnredvviatkaahrkqgndfvfdnspdflkksvdeslkrlntdyidl
fyihfpdehtpkdeavnalnemkkagkirsigvsnfsleqlkeankdglvdvlqgeynll
nreaektffpytkehnisfipyfplvsgllagkytedttfpegdlrneqehfkgerfken
irkvnklapiaekhnvdiphivlawylarpeidilipgakradqlidniktadvtlsqed
isfidklfapg

Timeline for d1pyfa_:

• d1pyfa_ first appeared in SCOP 1.67
  
• d1pyfa_ appears in SCOP 1.69
  
• d1pyfa_ appears in SCOP 1.73
  
• d1pyfa_ appears in the current release, SCOPe 2.08, called d1pyfa1