SCOPe 2.08: Domain d1pyfa1: 1pyf A:2-310

Lineage for d1pyfa1 (1pyf A:2-310)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein Putative oxidoreductase IolS [102054] (1 species)
   vegetative protein 147, VEG147, AKR11A

7. Species Bacillus subtilis [TaxId:1423] [102055] (2 PDB entries)

8. Domain d1pyfa1: 1pyf A:2-310 [95334]
   Other proteins in same PDB: d1pyfa2
   complexed with edo, na

Details for d1pyfa1

PDB Entry: 1pyf, 1.8 Å

PDB Description: Structure of NADPH-dependent family 11 aldo-keto reductase AKR11A(apo)

PDB Compounds: (A:) IolS protein

SCOPe Domain Sequences for d1pyfa1:

Sequence; same for both SEQRES and ATOM records:

>d1pyfa1 c.1.7.1 (A:2-310) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]}
kkaklgksdlqvfpiglgtnavgghnlypnlneetgkelvreairngvtmldtayiygig
rseeligevlrefnredvviatkaahrkqgndfvfdnspdflkksvdeslkrlntdyidl
fyihfpdehtpkdeavnalnemkkagkirsigvsnfsleqlkeankdglvdvlqgeynll
nreaektffpytkehnisfipyfplvsgllagkytedttfpegdlrneqehfkgerfken
irkvnklapiaekhnvdiphivlawylarpeidilipgakradqlidniktadvtlsqed
isfidklfa

Timeline for d1pyfa1:

• d1pyfa1 first appeared in SCOP 1.67, called d1pyfa_
  
• d1pyfa1 appears in SCOPe 2.07