PDB entry 1pyf

View 1pyf on RCSB PDB site
Description: Structure of NADPH-dependent family 11 aldo-keto reductase AKR11A(apo)
Class: oxidoreductase
Keywords: beta-alpha barrel, aldo-keto reductase, TIM barrel, OXIDOREDUCTASE
Deposited on 2003-07-08, released 2004-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.197
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IolS protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: IOLS OR SS92ER
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46336 (Start-309)
      • modified residue (50)
      • modified residue (142)
      • cloning artifact (310-311)
    Domains in SCOPe 2.07: d1pyfa1, d1pyfa2
  • Heterogens: NA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pyfA (A:)
    mkkaklgksdlqvfpiglgtnavgghnlypnlneetgkelvreairngvtmldtayiygi
    grseeligevlrefnredvviatkaahrkqgndfvfdnspdflkksvdeslkrlntdyid
    lfyihfpdehtpkdeavnalnemkkagkirsigvsnfsleqlkeankdglvdvlqgeynl
    lnreaektffpytkehnisfipyfplvsgllagkytedttfpegdlrneqehfkgerfke
    nirkvnklapiaekhnvdiphivlawylarpeidilipgakradqlidniktadvtlsqe
    disfidklfapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pyfA (A:)
    kkaklgksdlqvfpiglgtnavgghnlypnlneetgkelvreairngvtmldtayiygig
    rseeligevlrefnredvviatkaahrkqgndfvfdnspdflkksvdeslkrlntdyidl
    fyihfpdehtpkdeavnalnemkkagkirsigvsnfsleqlkeankdglvdvlqgeynll
    nreaektffpytkehnisfipyfplvsgllagkytedttfpegdlrneqehfkgerfken
    irkvnklapiaekhnvdiphivlawylarpeidilipgakradqlidniktadvtlsqed
    isfidklfapg