Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) |
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (15 proteins) Common fold covers whole protein structure |
Protein Putative oxidoreductase IolS [102054] (1 species) vegetative protein 147, VEG147, AKR11A |
Species Bacillus subtilis [TaxId:1423] [102055] (2 PDB entries) |
Domain d1pyfa_: 1pyf A: [95334] complexed with egl, na |
PDB Entry: 1pyf (more details), 1.8 Å
SCOP Domain Sequences for d1pyfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} kkaklgksdlqvfpiglgtnavgghnlypnlneetgkelvreairngvtmldtayiygig rseeligevlrefnredvviatkaahrkqgndfvfdnspdflkksvdeslkrlntdyidl fyihfpdehtpkdeavnalnemkkagkirsigvsnfsleqlkeankdglvdvlqgeynll nreaektffpytkehnisfipyfplvsgllagkytedttfpegdlrneqehfkgerfken irkvnklapiaekhnvdiphivlawylarpeidilipgakradqlidniktadvtlsqed isfidklfapg
Timeline for d1pyfa_: