Lineage for d1pxwa_ (1pxw A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.3: L30e-like [55315] (4 families) 
Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) 
Protein Ribosomal protein L7ae [55319] (7 species) 
Species Pyrococcus abyssi [TaxId:29292] [103081] (2 PDB entries) 
Domain d1pxwa_: 1pxw A: [95305]
Details for d1pxwa_
PDB Entry: 1pxw (more details), 1.94 Å
PDB Description: crystal structure of l7ae srnp core protein from pyrococcus abyssii
PDB Compounds: (A:) LSU ribosomal protein L7AESCOPe Domain Sequences for d1pxwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pxwa_ d.79.3.1 (A:) Ribosomal protein L7ae {Pyrococcus abyssi [TaxId: 29292]}
megwmmakpsyvkfevpkelaekalqaveiardtgkirkgtnettkavergqaklviiae
dvdpeeivahlpplceekeipyiyvpskkelgaaagievaaasvaiiepgkardlveeia
mkvrelmk
SCOPe Domain Coordinates for d1pxwa_:
Click to download the PDB-style file with coordinates for d1pxwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pxwa_:
- d1pxwa_ first appeared in SCOP 1.67
- d1pxwa_ appears in SCOPe 2.07
View in 3D
