Lineage for d1pxwa_ (1pxw A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 414157Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 414295Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 414296Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)
  6. 414312Protein Ribosomal protein L7ae [55319] (2 species)
  7. 414332Species Archaeon Pyrococcus abyssi [TaxId:29292] [103081] (1 PDB entry)
  8. 414333Domain d1pxwa_: 1pxw A: [95305]

Details for d1pxwa_

PDB Entry: 1pxw (more details), 1.94 Å

PDB Description: crystal structure of l7ae srnp core protein from pyrococcus abyssii

SCOP Domain Sequences for d1pxwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pxwa_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Pyrococcus abyssi}
megwmmakpsyvkfevpkelaekalqaveiardtgkirkgtnettkavergqaklviiae
dvdpeeivahlpplceekeipyiyvpskkelgaaagievaaasvaiiepgkardlveeia
mkvrelmk

SCOP Domain Coordinates for d1pxwa_:

Click to download the PDB-style file with coordinates for d1pxwa_.
(The format of our PDB-style files is described here.)

Timeline for d1pxwa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pxwb_