![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.3: L30e-like [55315] (4 families) ![]() |
![]() | Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) |
![]() | Protein Ribosomal protein L7ae [55319] (7 species) |
![]() | Species Pyrococcus abyssi [TaxId:29292] [103081] (2 PDB entries) |
![]() | Domain d1pxwb_: 1pxw B: [95306] |
PDB Entry: 1pxw (more details), 1.94 Å
SCOPe Domain Sequences for d1pxwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pxwb_ d.79.3.1 (B:) Ribosomal protein L7ae {Pyrococcus abyssi [TaxId: 29292]} psyvkfevpkelaekalqaveiardtgkirkgtnettkavergqaklviiaedvdpeeiv ahlpplceekeipyiyvpskkelgaaagievaaasvaiiepgkardlveeiamkvrelmk
Timeline for d1pxwb_: