Lineage for d1px2b2 (1px2 B:214-417)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1219586Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1219587Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families) (S)
  5. 1219749Family d.142.1.3: Synapsin C-terminal domain [56078] (2 proteins)
  6. 1219750Protein Synapsin [56079] (2 species)
  7. 1219756Species Norway rat (Rattus norvegicus) [TaxId:10116] [103285] (2 PDB entries)
  8. 1219766Domain d1px2b2: 1px2 B:214-417 [95276]
    Other proteins in same PDB: d1px2a1, d1px2b1
    complexed with atp, ca

Details for d1px2b2

PDB Entry: 1px2 (more details), 2.23 Å

PDB Description: Crystal Structure of Rat Synapsin I C Domain Complexed to Ca.ATP (Form 1)
PDB Compounds: (B:) Synapsin I

SCOPe Domain Sequences for d1px2b2:

Sequence, based on SEQRES records: (download)

>d1px2b2 d.142.1.3 (B:214-417) Synapsin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nslhsvynfcdkpwvfaqmvrlhkklgteefplidqtfypnhkemlssttypvvvkmgha
hsgmgkvkvdnqhdfqdiasvvaltktyataepfidakydvrvqkigqnykaymrtsvsg
nwktntgsamleqiamsdryklwvdtcseifggldicavealhgkdgrdhiievvgssmp
ligdhqdedkqlivelvvnkmtqa

Sequence, based on observed residues (ATOM records): (download)

>d1px2b2 d.142.1.3 (B:214-417) Synapsin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nslhsvynfcdkpwvfaqmvrlhkklgteefplidqtfypnhkemlssttypvvvkmgha
hsgmgkvkvdnqhdfqdiasvvaltktyataepfidakydvrvqkigqnykaymrtwktl
eqiamsdryklwvdtcseifggldicavealhgkdgrdhiievvgssmpligdhqdedkq
livelvvnkmtqa

SCOPe Domain Coordinates for d1px2b2:

Click to download the PDB-style file with coordinates for d1px2b2.
(The format of our PDB-style files is described here.)

Timeline for d1px2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1px2b1