![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.3: Synapsin C-terminal domain [56078] (3 proteins) automatically mapped to Pfam PF02750 |
![]() | Protein Synapsin [56079] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [103285] (2 PDB entries) |
![]() | Domain d1px2b2: 1px2 B:214-417 [95276] Other proteins in same PDB: d1px2a1, d1px2b1 complexed with atp, ca |
PDB Entry: 1px2 (more details), 2.23 Å
SCOPe Domain Sequences for d1px2b2:
Sequence, based on SEQRES records: (download)
>d1px2b2 d.142.1.3 (B:214-417) Synapsin {Norway rat (Rattus norvegicus) [TaxId: 10116]} nslhsvynfcdkpwvfaqmvrlhkklgteefplidqtfypnhkemlssttypvvvkmgha hsgmgkvkvdnqhdfqdiasvvaltktyataepfidakydvrvqkigqnykaymrtsvsg nwktntgsamleqiamsdryklwvdtcseifggldicavealhgkdgrdhiievvgssmp ligdhqdedkqlivelvvnkmtqa
>d1px2b2 d.142.1.3 (B:214-417) Synapsin {Norway rat (Rattus norvegicus) [TaxId: 10116]} nslhsvynfcdkpwvfaqmvrlhkklgteefplidqtfypnhkemlssttypvvvkmgha hsgmgkvkvdnqhdfqdiasvvaltktyataepfidakydvrvqkigqnykaymrtwktl eqiamsdryklwvdtcseifggldicavealhgkdgrdhiievvgssmpligdhqdedkq livelvvnkmtqa
Timeline for d1px2b2: