SCOPe 2.02: Domain d1px2a2: 1px2 A:214-417

Lineage for d1px2a2 (1px2 A:214-417)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families)

5. Family d.142.1.3: Synapsin C-terminal domain [56078] (2 proteins)

6. Protein Synapsin [56079] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [103285] (2 PDB entries)

8. Domain d1px2a2: 1px2 A:214-417 [95274]
   Other proteins in same PDB: d1px2a1, d1px2b1
   complexed with atp, ca

Details for d1px2a2

PDB Entry: 1px2, 2.23 Å

PDB Description: Crystal Structure of Rat Synapsin I C Domain Complexed to Ca.ATP (Form 1)

PDB Compounds: (A:) Synapsin I

SCOPe Domain Sequences for d1px2a2:

Sequence, based on SEQRES records:

>d1px2a2 d.142.1.3 (A:214-417) Synapsin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nslhsvynfcdkpwvfaqmvrlhkklgteefplidqtfypnhkemlssttypvvvkmgha
hsgmgkvkvdnqhdfqdiasvvaltktyataepfidakydvrvqkigqnykaymrtsvsg
nwktntgsamleqiamsdryklwvdtcseifggldicavealhgkdgrdhiievvgssmp
ligdhqdedkqlivelvvnkmtqa

Sequence, based on observed residues (ATOM records):

>d1px2a2 d.142.1.3 (A:214-417) Synapsin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nslhsvynfcdkpwvfaqmvrlhkklgteefplidqtfypnhkemlssttypvvvkmgha
hsgmgkvkvdnqhdfqdiasvvaltktyataepfidakydvrvqkigqnykaymrtwkle
qiamsdryklwvdtcseifggldicavealhgkdgrdhiievvgssmpligdhqdedkql
ivelvvnkmtqa

Timeline for d1px2a2:

• d1px2a2 first appeared in SCOP 1.67
  
• d1px2a2 appears in SCOPe 2.01
  
• d1px2a2 appears in SCOPe 2.03
  
• d1px2a2 appears in the current release, SCOPe 2.08