Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) |
Family d.142.1.3: Synapsin C-terminal domain [56078] (3 proteins) automatically mapped to Pfam PF02750 |
Protein Synapsin [56079] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [103285] (2 PDB entries) |
Domain d1px2a2: 1px2 A:214-417 [95274] Other proteins in same PDB: d1px2a1, d1px2b1 complexed with atp, ca |
PDB Entry: 1px2 (more details), 2.23 Å
SCOPe Domain Sequences for d1px2a2:
Sequence, based on SEQRES records: (download)
>d1px2a2 d.142.1.3 (A:214-417) Synapsin {Norway rat (Rattus norvegicus) [TaxId: 10116]} nslhsvynfcdkpwvfaqmvrlhkklgteefplidqtfypnhkemlssttypvvvkmgha hsgmgkvkvdnqhdfqdiasvvaltktyataepfidakydvrvqkigqnykaymrtsvsg nwktntgsamleqiamsdryklwvdtcseifggldicavealhgkdgrdhiievvgssmp ligdhqdedkqlivelvvnkmtqa
>d1px2a2 d.142.1.3 (A:214-417) Synapsin {Norway rat (Rattus norvegicus) [TaxId: 10116]} nslhsvynfcdkpwvfaqmvrlhkklgteefplidqtfypnhkemlssttypvvvkmgha hsgmgkvkvdnqhdfqdiasvvaltktyataepfidakydvrvqkigqnykaymrtwkle qiamsdryklwvdtcseifggldicavealhgkdgrdhiievvgssmpligdhqdedkql ivelvvnkmtqa
Timeline for d1px2a2: