Lineage for d1pvha1 (1pvh A:101-196)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761729Protein Cytokine receptor gp130 cytokine-binding domains [49295] (1 species)
  7. 2761730Species Human (Homo sapiens) [TaxId:9606] [49296] (5 PDB entries)
  8. 2761738Domain d1pvha1: 1pvh A:101-196 [95165]
    Other proteins in same PDB: d1pvhb_, d1pvhd_
    complexed with iod

Details for d1pvha1

PDB Entry: 1pvh (more details), 2.5 Å

PDB Description: Crystal structure of leukemia inhibitory factor in complex with gp130
PDB Compounds: (A:) interleukin-6 receptor beta chain

SCOPe Domain Sequences for d1pvha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvha1 b.1.2.1 (A:101-196) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}
glppekpknlscivnegkkmrcewdggrethletnftlksewathkfadckakrdtptsc
tvdystvyfvnievwveaenalgkvtsdhinfdpvy

SCOPe Domain Coordinates for d1pvha1:

Click to download the PDB-style file with coordinates for d1pvha1.
(The format of our PDB-style files is described here.)

Timeline for d1pvha1: