Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Cytokine receptor gp130 cytokine-binding domains [49295] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49296] (5 PDB entries) |
Domain d1pvha2: 1pvh A:197-301 [95166] Other proteins in same PDB: d1pvhb_, d1pvhd_ complexed with iod |
PDB Entry: 1pvh (more details), 2.5 Å
SCOPe Domain Sequences for d1pvha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pvha2 b.1.2.1 (A:197-301) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} kvkpnpphnlsvinseelssilkltwtnpsiksviilkyniqyrtkdastwsqippedta strssftvqdlkpfteyvfrircmkedgkgywsdwseeasgitye
Timeline for d1pvha2:
View in 3D Domains from other chains: (mouse over for more information) d1pvhb_, d1pvhc1, d1pvhc2, d1pvhd_ |