Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein pbx1 [46711] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [46712] (2 PDB entries) |
Domain d1pufb_: 1puf B: [95132] Other proteins in same PDB: d1pufa_ protein/DNA complex |
PDB Entry: 1puf (more details), 1.9 Å
SCOPe Domain Sequences for d1pufb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} arrkrrnfnkqateilneyfyshlsnpypseeakeelakkcgitvsqvsnwfgnkriryk knigkfqeeaniy
Timeline for d1pufb_: