Lineage for d1pufa_ (1puf A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1720411Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1720412Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 1720474Protein Homeobox protein hox-a9 [100994] (1 species)
  7. 1720475Species Mouse (Mus musculus) [TaxId:10090] [100995] (1 PDB entry)
  8. 1720476Domain d1pufa_: 1puf A: [95131]
    Other proteins in same PDB: d1pufb_
    protein/DNA complex

Details for d1pufa_

PDB Entry: 1puf (more details), 1.9 Å

PDB Description: Crystal Structure of HoxA9 and Pbx1 homeodomains bound to DNA
PDB Compounds: (A:) Homeobox protein Hox-A9

SCOPe Domain Sequences for d1pufa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]}
nnpaanwlharstrkkrcpytkhqtlelekeflfnmyltrdrryevarllnlterqvkiw
fqnrrmkmkkinkdrak

SCOPe Domain Coordinates for d1pufa_:

Click to download the PDB-style file with coordinates for d1pufa_.
(The format of our PDB-style files is described here.)

Timeline for d1pufa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pufb_