PDB entry 1puf

View 1puf on RCSB PDB site
Description: Crystal Structure of HoxA9 and Pbx1 homeodomains bound to DNA
Class: Transcription/DNA
Keywords: Homeodomian, Protein-DNA complex, Hox Hexapeptide, TALE homeodomain, Homeodomain interaction, Transcription/DNA COMPLEX
Deposited on 2003-06-24, released 2003-09-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.233
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox protein Hox-A9
    Species: Mus musculus [TaxId:10090]
    Gene: HOXA9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pufa_
  • Chain 'B':
    Compound: Pre-B-cell leukemia transcription factor-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PBX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pufb_
  • Chain 'D':
    Compound: 5'-d(*ap*cp*tp*cp*tp*ap*tp*gp*ap*tp*tp*tp*ap*cp*gp*ap*cp*gp*cp*t)-3'
  • Chain 'E':
    Compound: 5'-d(*tp*ap*gp*cp*gp*tp*cp*gp*tp*ap*ap*ap*tp*cp*ap*tp*ap*gp*ap*g)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pufA (A:)
nnpaanwlharstrkkrcpytkhqtlelekeflfnmyltrdrryevarllnlterqvkiw
fqnrrmkmkkinkdrak

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pufB (B:)
arrkrrnfnkqateilneyfyshlsnpypseeakeelakkcgitvsqvsnwfgnkriryk
knigkfqeeaniy

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.