SCOPe 2.05: Domain d1pu8b_: 1pu8 B:

Lineage for d1pu8b_ (1pu8 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.5: 3-Methyladenine DNA glycosylase III (MagIII) [101349] (1 protein)

6. Protein 3-Methyladenine DNA glycosylase III (MagIII) [101350] (1 species)

7. Species Helicobacter pylori [TaxId:210] [101351] (3 PDB entries)

8. Domain d1pu8b_: 1pu8 B: [95128]
   complexed with bme, ea1

Details for d1pu8b_

PDB Entry: 1pu8, 2.13 Å

PDB Description: Crystal structure of H.pylori 3-methyladenine DNA glycosylase (MagIII) bound to 1,N6-ethenoadenine

PDB Compounds: (B:) 3-methyladenine DNA glycosylase

SCOPe Domain Sequences for d1pu8b_:

Sequence; same for both SEQRES and ATOM records:

>d1pu8b_ a.96.1.5 (B:) 3-Methyladenine DNA glycosylase III (MagIII) {Helicobacter pylori [TaxId: 210]}
ldsfeilkalksldllknapawwwpnalkfeallgavltqntkfeavlkslenlknafil
enddeinlkkiayiefsklaecvrpsgfynqkakrlidlsgnilkdfqsfenfkqevtre
wlldqkgigkesadailcyacakevmvvdkysylflkklgieiedydelqhffekgvqen
lnsalalyentislaqlyarfhgkivefskqklel

Timeline for d1pu8b_:

• d1pu8b_ first appeared in SCOP 1.67
  
• d1pu8b_ appears in SCOPe 2.04
  
• d1pu8b_ appears in SCOPe 2.06
  
• d1pu8b_ appears in the current release, SCOPe 2.08