Lineage for d1pu8b_ (1pu8 B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358646Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 358647Superfamily a.96.1: DNA-glycosylase [48150] (5 families) (S)
  5. 358705Family a.96.1.5: 3-Methyladenine DNA glycosylase III (MagIII) [101349] (1 protein)
  6. 358706Protein 3-Methyladenine DNA glycosylase III (MagIII) [101350] (1 species)
  7. 358707Species Helicobacter pylori [TaxId:210] [101351] (3 PDB entries)
  8. 358713Domain d1pu8b_: 1pu8 B: [95128]
    complexed with ea1, seo

Details for d1pu8b_

PDB Entry: 1pu8 (more details), 2.13 Å

PDB Description: Crystal structure of H.pylori 3-methyladenine DNA glycosylase (MagIII) bound to 1,N6-ethenoadenine

SCOP Domain Sequences for d1pu8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pu8b_ a.96.1.5 (B:) 3-Methyladenine DNA glycosylase III (MagIII) {Helicobacter pylori}
ldsfeilkalksldllknapawwwpnalkfeallgavltqntkfeavlkslenlknafil
enddeinlkkiayiefsklaecvrpsgfynqkakrlidlsgnilkdfqsfenfkqevtre
wlldqkgigkesadailcyacakevmvvdkysylflkklgieiedydelqhffekgvqen
lnsalalyentislaqlyarfhgkivefskqklel

SCOP Domain Coordinates for d1pu8b_:

Click to download the PDB-style file with coordinates for d1pu8b_.
(The format of our PDB-style files is described here.)

Timeline for d1pu8b_: