Lineage for d1pu8b_ (1pu8 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006171Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2006172Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2006294Family a.96.1.5: 3-Methyladenine DNA glycosylase III (MagIII) [101349] (1 protein)
  6. 2006295Protein 3-Methyladenine DNA glycosylase III (MagIII) [101350] (1 species)
  7. 2006296Species Helicobacter pylori [TaxId:210] [101351] (3 PDB entries)
  8. 2006302Domain d1pu8b_: 1pu8 B: [95128]
    complexed with bme, ea1

Details for d1pu8b_

PDB Entry: 1pu8 (more details), 2.13 Å

PDB Description: Crystal structure of H.pylori 3-methyladenine DNA glycosylase (MagIII) bound to 1,N6-ethenoadenine
PDB Compounds: (B:) 3-methyladenine DNA glycosylase

SCOPe Domain Sequences for d1pu8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pu8b_ a.96.1.5 (B:) 3-Methyladenine DNA glycosylase III (MagIII) {Helicobacter pylori [TaxId: 210]}
ldsfeilkalksldllknapawwwpnalkfeallgavltqntkfeavlkslenlknafil
enddeinlkkiayiefsklaecvrpsgfynqkakrlidlsgnilkdfqsfenfkqevtre
wlldqkgigkesadailcyacakevmvvdkysylflkklgieiedydelqhffekgvqen
lnsalalyentislaqlyarfhgkivefskqklel

SCOPe Domain Coordinates for d1pu8b_:

Click to download the PDB-style file with coordinates for d1pu8b_.
(The format of our PDB-style files is described here.)

Timeline for d1pu8b_: