Lineage for d1pu7b_ (1pu7 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720979Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2720980Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2721112Family a.96.1.5: 3-Methyladenine DNA glycosylase III (MagIII) [101349] (1 protein)
  6. 2721113Protein 3-Methyladenine DNA glycosylase III (MagIII) [101350] (1 species)
  7. 2721114Species Helicobacter pylori [TaxId:210] [101351] (3 PDB entries)
  8. 2721118Domain d1pu7b_: 1pu7 B: [95126]
    complexed with 39a, bme

Details for d1pu7b_

PDB Entry: 1pu7 (more details), 1.93 Å

PDB Description: Crystal structure of H.pylori 3-methyladenine DNA glycosylase (MagIII) bound to 3,9-dimethyladenine
PDB Compounds: (B:) 3-methyladenine DNA glycosylase

SCOPe Domain Sequences for d1pu7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pu7b_ a.96.1.5 (B:) 3-Methyladenine DNA glycosylase III (MagIII) {Helicobacter pylori [TaxId: 210]}
vldsfeilkalksldllknapawwwpnalkfeallgavltqntkfeavlkslenlknafi
lenddeinlkkiayiefsklaecvrpsgfynqkakrlidlsgnilkdfqsfenfkqevtr
ewlldqkgigkesadailcyacakevmvvdkysylflkklgieiedydelqhffekgvqe
nlnsalalyentislaqlyarfhgkivefskqklel

SCOPe Domain Coordinates for d1pu7b_:

Click to download the PDB-style file with coordinates for d1pu7b_.
(The format of our PDB-style files is described here.)

Timeline for d1pu7b_: