SCOP 1.67: Domain d1pu7b_: 1pu7 B:

Lineage for d1pu7b_ (1pu7 B:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (5 families)

5. Family a.96.1.5: 3-Methyladenine DNA glycosylase III (MagIII) [101349] (1 protein)

6. Protein 3-Methyladenine DNA glycosylase III (MagIII) [101350] (1 species)

7. Species Helicobacter pylori [TaxId:210] [101351] (3 PDB entries)

8. Domain d1pu7b_: 1pu7 B: [95126]
   complexed with 39a, seo

Details for d1pu7b_

PDB Entry: 1pu7, 1.93 Å

PDB Description: Crystal structure of H.pylori 3-methyladenine DNA glycosylase (MagIII) bound to 3,9-dimethyladenine

SCOP Domain Sequences for d1pu7b_:

Sequence; same for both SEQRES and ATOM records:

>d1pu7b_ a.96.1.5 (B:) 3-Methyladenine DNA glycosylase III (MagIII) {Helicobacter pylori}
vldsfeilkalksldllknapawwwpnalkfeallgavltqntkfeavlkslenlknafi
lenddeinlkkiayiefsklaecvrpsgfynqkakrlidlsgnilkdfqsfenfkqevtr
ewlldqkgigkesadailcyacakevmvvdkysylflkklgieiedydelqhffekgvqe
nlnsalalyentislaqlyarfhgkivefskqklel

Timeline for d1pu7b_:

• d1pu7b_ is new in SCOP 1.67
  
• d1pu7b_ appears in SCOP 1.69
  
• d1pu7b_ appears in the current release, SCOPe 2.08