Lineage for d1pu7a_ (1pu7 A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. Family a.96.1.5: 3-Methyladenine DNA glycosylase III (MagIII) [101349] (1 protein)
  6. Protein 3-Methyladenine DNA glycosylase III (MagIII) [101350] (1 species)
  7. Species Helicobacter pylori [TaxId:210] [101351] (3 PDB entries)
  8. Domain d1pu7a_: 1pu7 A: [95125]
    complexed with 39a, bme

Details for d1pu7a_

PDB Entry: 1pu7 (more details), 1.93 Å

PDB Description: Crystal structure of H.pylori 3-methyladenine DNA glycosylase (MagIII) bound to 3,9-dimethyladenine
PDB Compounds: (A:) 3-methyladenine DNA glycosylase

SCOPe Domain Sequences for d1pu7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pu7a_ a.96.1.5 (A:) 3-Methyladenine DNA glycosylase III (MagIII) {Helicobacter pylori [TaxId: 210]}
ldsfeilkalksldllknapawwwpnalkfeallgavltqntkfeavlkslenlknafil
enddeinlkkiayiefsklaecvrpsgfynqkakrlidlsgnilkdfqsfenfkqevtre
wlldqkgigkesadailcyacakevmvvdkysylflkklgieiedydelqhffekgvqen
lnsalalyentislaqlyarfhgkivefskqklel

SCOPe Domain Coordinates for d1pu7a_ are not available.

Timeline for d1pu7a_:

Domains from other chains:
(mouse over for more information)
d1pu7b_